PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29247.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 1004aa    MW: 110633 Da    PI: 5.1522
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29247.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-173783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd++l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
       KHN29247.1 37 KGQWTSEEDDILQNAVERFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding65.88.2e-2189135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++++vk++G++ W+tIa++++ gR +kqc++rw ++l
       KHN29247.1  89 KGPWSKEEDEIIIELVKKHGPKKWSTIAQHLP-GRIGKQCRERWVNHL 135
                      79******************************.************996 PP

3Myb_DNA-binding45.41.8e-14141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT eE++ l+++++ +G++ W+  ++ ++ gRt++ +k++w+
       KHN29247.1 141 KEAWTREEELALIHYHQIFGNK-WAELSKVIP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.543283IPR017930Myb domain
SMARTSM007176.6E-143685IPR001005SANT/Myb domain
PfamPF002491.1E-143783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-213895IPR009057Homeodomain-like
SuperFamilySSF466895.24E-153893IPR009057Homeodomain-like
CDDcd001671.08E-124083No hitNo description
PROSITE profilePS5129432.39784139IPR017930Myb domain
SuperFamilySSF466895.87E-3186182IPR009057Homeodomain-like
SMARTSM007171.6E-1988137IPR001005SANT/Myb domain
PfamPF002493.1E-1989135IPR001005SANT/Myb domain
CDDcd001672.22E-1791135No hitNo description
Gene3DG3DSA:1.10.10.602.8E-2796142IPR009057Homeodomain-like
SMARTSM007172.5E-14140188IPR001005SANT/Myb domain
PROSITE profilePS5129419.277140190IPR017930Myb domain
PfamPF002497.2E-13141184IPR001005SANT/Myb domain
CDDcd001677.33E-11143183No hitNo description
Gene3DG3DSA:1.10.10.605.0E-21143190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1004 aa     Download sequence    Send to blast
MDGEQSMPAP SHGQVDGAQK VRALHGRTTG PTRRSTKGQW TSEEDDILQN AVERFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEII IELVKKHGPK KWSTIAQHLP  120
GRIGKQCRER WVNHLDPTIK KEAWTREEEL ALIHYHQIFG NKWAELSKVI PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLT QFESIPPHAG NLNQPIRLQC SGDDNGSKWT EGEEISDYSQ  240
GSANAVYFPS ATGTSSADLQ TGEAYRKNEE CSLGKDHCPN QVSCSEPYYV SNDDVSICIP  300
EIAHQEACTS QFVEQQSHEP GNSICGDCQF NFQSSPNVSS MVLGQESSEL QRDFIAPSEI  360
CDMVNVPFPT SVELGVSTSM GTASMDSLKP EHMLISDDEC CRVLFSDAMN DGCFPPVDYN  420
KSEDIAEFSG YCSFCRSCNI QISETGGTST AKLTCPQCSN NYKGISSSQS VPPVLSIRDD  480
RLGPSANSNQ LFVTEDHHFV SRASANFTYL NDISCSPCVD GIGSAVMEKT NVHTEKEDSG  540
SLCYEPPRFP SLDIPFFSCD LVQSGSDMQQ EFSPLGIRQF MMSSMNCLTP FRLWDSPSRD  600
DNPDALLKSA AKTFTGTPSI LKKRSRDLLS PLSDKRMDKK LETDITSSMF TRNFSSLDVT  660
FGDNETRKAD MPSSSLQTQN SRASVDDDNK ENCGQTYKGE QVLEPIKSAI LDEKNSQKGT  720
VDGNSQHNVK QQPLDSKMKI NAAAGIEQQQ SGVLVEHDVN DLSLSSPDQV GLNSDRGLDS  780
SAKTPKSLNK SLEAASNQSG HLKLSSKSPC PRVNSCSPCV RAKEHEGLSV AVTRVQAPGD  840
NSGEQTRRDG GFETSSIFGG TPSAWKSPWF FNTFLSSPRL DTEILIEDFG YFMSPGDRSY  900
DALGWLKQVS DQTAATYANA QEILANGTPK ALPKDASEND KDRDHENNYP ANQPGNHSQL  960
ASNALIERRT LDFSECETPG RGDNSKSSAM SFSSPSSYLM KGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-66371906159MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-66371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003545596.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
TrEMBLA0A0B2RBI90.0A0A0B2RBI9_GLYSO; Myb-related protein 3R-1
TrEMBLK7M6R30.0K7M6R3_SOYBN; Uncharacterized protein
STRINGGLYMA14G21523.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]